PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00377.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 308aa    MW: 34308 Da    PI: 8.118
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00377.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1761e-54221491128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              +ppGfrFhPtdeel+++yL kkv ++++++  +i++vd++k+ePw+Lp+k+k +ekew+fF+ rd+ky++g r+nrat++gyWkat
  Rsa1.0_00377.1_g00002.1  22 MPPGFRFHPTDEELITYYLLKKVLDSNFSC-AAISQVDLNKCEPWELPEKAKMGEKEWHFFTLRDRKYPRGLRTNRATEAGYWKAT 106
                              79****************************.88***************99999********************************* PP

                      NAM  87 gkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                              gkd+e++s+ +++l g+kktLvfykgrapkgek++Wvmheyrl
  Rsa1.0_00377.1_g00002.1 107 GKDREIKSSkTKSLLGMKKTLVFYKGRAPKGEKSSWVMHEYRL 149
                              *******9856677***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.8E-6119174IPR003441NAC domain
PROSITE profilePS5100556.93822174IPR003441NAC domain
PfamPF023654.5E-2823149IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MDIDVLNGWE RSRFEDETVM HMPPGFRFHP TDEELITYYL LKKVLDSNFS CAAISQVDLN  60
KCEPWELPEK AKMGEKEWHF FTLRDRKYPR GLRTNRATEA GYWKATGKDR EIKSSKTKSL  120
LGMKKTLVFY KGRAPKGEKS SWVMHEYRLD GKFSYHYITS SAKDEWVLSK VCLKSSVVSR  180
ETKLFSSSVT GVSCSSSAGS VIAPVIDTFA TEHVSCFSNT SSSASHADAS FPTYLPAPPP  240
SLPRQPCSID DDVEFGQFMG PGSSGQLNID AAFLPNQLSM PPTVLPLPPP RSYALYGGAA  300
VSSWPFAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B4e-501818013171NAC domain-containing protein 19
4dul_A4e-501818013171NAC domain-containing protein 19
1ut7_B4e-501818013171NO APICAL MERISTEM PROTEIN
1ut7_A4e-501818013171NO APICAL MERISTEM PROTEIN
1ut4_B4e-501818013171NO APICAL MERISTEM PROTEIN
1ut4_A4e-501818013171NO APICAL MERISTEM PROTEIN
3swp_D5e-501818016174NAC domain-containing protein 19
3swp_C5e-501818016174NAC domain-containing protein 19
3swp_B5e-501818016174NAC domain-containing protein 19
3swp_A5e-501818016174NAC domain-containing protein 19
3swm_D5e-501818016174NAC domain-containing protein 19
3swm_C5e-501818016174NAC domain-containing protein 19
3swm_B5e-501818016174NAC domain-containing protein 19
3swm_A5e-501818016174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006407005.11e-176hypothetical protein EUTSA_v10021186mg
SwissprotQ9FRV41e-149NAC54_ARATH; Protein CUP-SHAPED COTYLEDON 1
TrEMBLV4M7W31e-176V4M7W3_EUTSA; Uncharacterized protein
STRINGBra021592.1-P1e-166(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM134811528
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15170.11e-134NAC family protein